Crystal structure of the n-terminal fragment (31-127) of the mouse hepatocyte growth factor/scatter factor
PDB DOI: 10.2210/pdb3hmr/pdb
Classification: HORMONE Organism(s): Mus Musculus
Deposited: 2009-05-29 Deposition Author(s): Tolbert, W.D.
Crystal structure of the n-terminal fragment (31-127) of the mouse hepatocyte growth factor/scatter factor
Primary Citation of Related Structures: 3HMR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hepatocyte growth factor | A | 99 | Mus Musculus | GSEGQKKRRNTLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIR |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-05-29 Deposition Author(s): Tolbert, W.D.