Crystal structure of the signaling helix coiled-coil doimain of the beta-1 subunit of the soluble guanylyl cyclase
PDB DOI: 10.2210/pdb3hls/pdb
Classification: SIGNALING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2009-05-28 Deposition Author(s): Ma, X. , Van Den Akker, F.
Method: X-RAY DIFFRACTION Resolution: 2.15 Å
Crystal structure of the signaling helix coiled-coil doimain of the beta-1 subunit of the soluble guanylyl cyclase
Primary Citation of Related Structures: 3HLS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Guanylate cyclase soluble subunit beta-1 | A | 66 | Rattus Norvegicus | GSHMATRDLVLLGEQFREEYKLTQELEMLTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHK |
| Guanylate cyclase soluble subunit beta-1 | B | 66 | Rattus Norvegicus | GSHMATRDLVLLGEQFREEYKLTQELEMLTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHK |
| Guanylate cyclase soluble subunit beta-1 | C | 66 | Rattus Norvegicus | GSHMATRDLVLLGEQFREEYKLTQELEMLTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHK |
| Guanylate cyclase soluble subunit beta-1 | D | 66 | Rattus Norvegicus | GSHMATRDLVLLGEQFREEYKLTQELEMLTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHK |
| Guanylate cyclase soluble subunit beta-1 | E | 66 | Rattus Norvegicus | GSHMATRDLVLLGEQFREEYKLTQELEMLTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHK |
| Guanylate cyclase soluble subunit beta-1 | F | 66 | Rattus Norvegicus | GSHMATRDLVLLGEQFREEYKLTQELEMLTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHK |
| Guanylate cyclase soluble subunit beta-1 | G | 66 | Rattus Norvegicus | GSHMATRDLVLLGEQFREEYKLTQELEMLTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHK |
| Guanylate cyclase soluble subunit beta-1 | H | 66 | Rattus Norvegicus | GSHMATRDLVLLGEQFREEYKLTQELEMLTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHK |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-05-28 Deposition Author(s): Ma, X. , Van Den Akker, F.