Ferric horse heart myoglobin; h64v mutant, nitrite modified
PDB DOI: 10.2210/pdb3hep/pdb
Classification: OXYGEN TRANSPORT Organism(s): Equus Caballus
Deposited: 2009-05-09 Deposition Author(s): Richter-Addo, G.B. , Thomas, L.M. , Yi, J.
Ferric horse heart myoglobin; h64v mutant, nitrite modified
Richter-Addo, G.B. , Thomas, L.M. , Yi, J.
Primary Citation of Related Structures: 3HEP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myoglobin | A | 153 | Equus Caballus | GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKVGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-05-09 Deposition Author(s): Richter-Addo, G.B. , Thomas, L.M. , Yi, J.