Class iv chitinase structure from picea abies at 1.8a
PDB DOI: 10.2210/pdb3hbd/pdb
Classification: HYDROLASE Organism(s): Picea Abies
Deposited: 2009-05-04 Deposition Author(s): Mowbray, S.L. , Ubhayasekera, W.
Class iv chitinase structure from picea abies at 1.8a
Mowbray, S.L. , Ubhayasekera, W.
Primary Citation of Related Structures: 3HBD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Class IV chitinase Chia4-Pa2 | A | 204 | Picea Abies | SVGGIISQSFFNGLAGGAASSCEGKGFYTYNAFIAAANAYSGFGTTGSNDVKKRELAAFFANVMHETGGLCYINEKNPPINYCQSSSTWPCTSGKSYHGRGPLQLSWNYNYGAAGKSIGFDGLNNPEKVGQDSTISFKTAVWFWMKNSNCHSAITSGQGFGGTIKAINSMECNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-05-04 Deposition Author(s): Mowbray, S.L. , Ubhayasekera, W.