The structure of the caulobacter crescentus clps protease adaptor protein in complex with fgg tripeptide
PDB DOI: 10.2210/pdb3gw1/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Caulobacter Vibrioides , Synthetic Construct
Deposited: 2009-03-31 Deposition Author(s): Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T.
The structure of the caulobacter crescentus clps protease adaptor protein in complex with fgg tripeptide
Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T.
Primary Citation of Related Structures: 3GW1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATP-dependent Clp protease adapter protein ClpS | A | 85 | Caulobacter Vibrioides , Synthetic Construct | TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD |
| ATP-dependent Clp protease adapter protein ClpS | B | 85 | Caulobacter Vibrioides , Synthetic Construct | TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD |
| FGG peptide | C | 3 | Caulobacter Vibrioides , Synthetic Construct | FGG |
| FGG peptide | D | 3 | Caulobacter Vibrioides , Synthetic Construct | FGG |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-03-31 Deposition Author(s): Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T.