Crystal structure of human chromobox homolog 6 (cbx6) with h3k9 peptide
PDB DOI: 10.2210/pdb3gv6/pdb
Classification: Transcription/DNA binding protein Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-03-30 Deposition Author(s): Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Dong, A. , Edwards, A.M. , Kozieradzki, I. , Li, Z. , Loppnau, P. , Min, J. , Ouyang, H. , Structural Genomics Consortium (Sgc) , Weigelt, J.
Crystal structure of human chromobox homolog 6 (cbx6) with h3k9 peptide
Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Dong, A. , Edwards, A.M. , Kozieradzki, I. , Li, Z. , Loppnau, P. , Min, J. , Ouyang, H. , Structural Genomics Consortium (Sgc) , Weigelt, J.
Primary Citation of Related Structures: 3GV6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 6 | A | 58 | Homo Sapiens , Synthetic Construct | ERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERE |
| Histone H3K9me3 peptide | B | 15 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-03-30 Deposition Author(s): Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Dong, A. , Edwards, A.M. , Kozieradzki, I. , Li, Z. , Loppnau, P. , Min, J. , Ouyang, H. , Structural Genomics Consortium (Sgc) , Weigelt, J.