Quaternary structure of drosophila melanogaster ic/tctex-1/lc8; allosteric interactions of dynein light chains with dynein intermediate chain
PDB DOI: 10.2210/pdb3glw/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2009-03-12 Deposition Author(s): Barbar, E.J. , Hall, J.D. , Karplus, P.A.
Quaternary structure of drosophila melanogaster ic/tctex-1/lc8; allosteric interactions of dynein light chains with dynein intermediate chain
Barbar, E.J. , Hall, J.D. , Karplus, P.A.
Primary Citation of Related Structures: 3GLW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dynein light chain 1, cytoplasmic | A | 89 | Drosophila Melanogaster , Synthetic Construct | MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG |
| Dynein intermediate Chain | Z | 28 | Drosophila Melanogaster , Synthetic Construct | NLVYTKQTQTTPPKETLVYTKQTQTTST |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-03-12 Deposition Author(s): Barbar, E.J. , Hall, J.D. , Karplus, P.A.