Crystal structure of jarid1a-phd3 complexed with h3(1-9)k4me3 peptide
PDB DOI: 10.2210/pdb3gl6/pdb
Classification: OXIDOREDUCTASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-03-11 Deposition Author(s): Patel, D.J. , Song, J. , Wang, Z.
Crystal structure of jarid1a-phd3 complexed with h3(1-9)k4me3 peptide
Patel, D.J. , Song, J. , Wang, Z.
Primary Citation of Related Structures: 3GL6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Histone demethylase JARID1A | A | 52 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA |
Histone H3 | B | 9 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARK |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-03-11 Deposition Author(s): Patel, D.J. , Song, J. , Wang, Z.