Crystal structure of jarid1a-phd3 complexed with h3(1-9)k4me3 peptide
PDB DOI: 10.2210/pdb3gl6/pdb
Classification: OXIDOREDUCTASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-03-11 Deposition Author(s): Patel, D.J. , Song, J. , Wang, Z.
Crystal structure of jarid1a-phd3 complexed with h3(1-9)k4me3 peptide
Patel, D.J. , Song, J. , Wang, Z.
Primary Citation of Related Structures: 3GL6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Histone demethylase JARID1A | A | 52 | Homo Sapiens , Synthetic Construct | SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA |
Histone H3 | B | 9 | Homo Sapiens , Synthetic Construct | ARTKQTARK |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-03-11 Deposition Author(s): Patel, D.J. , Song, J. , Wang, Z.