Structure of the n-terminal domain of the e. coli protein mqsa (ygit/b3021)
PDB DOI: 10.2210/pdb3ga8/pdb
Classification: DNA BINDING PROTEIN Organism(s): Sphingobium Sp. (Strain Nbrc 103272 / Syk-6)
Deposited: 2009-02-16 Deposition Author(s): Arruda, J.M. , Brown, B.L. , Page, R. , Peti, W.
Structure of the n-terminal domain of the e. coli protein mqsa (ygit/b3021)
Arruda, J.M. , Brown, B.L. , Page, R. , Peti, W.
Primary Citation of Related Structures: 3GA8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
HTH-type transcriptional regulator MqsA (YgiT/B3021) | A | 78 | Sphingobium Sp. (Strain Nbrc 103272 / Syk-6) | GHMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVK |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-02-16 Deposition Author(s): Arruda, J.M. , Brown, B.L. , Page, R. , Peti, W.