Aleglitaar. a new. potent, and balanced dual ppara/g agonist for the treatment of type ii diabetes
PDB DOI: 10.2210/pdb3g9e/pdb
Classification: TRANSCRIPTION/TRANSFERASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-02-13 Deposition Author(s): Benz, J. , Bernardeau, A. , Binggeli, A. , Blum, D. , Boehringer, M. , Grether, U. , Gsell, B. , Hilpert, H. , Kuhn, B. , Maerki, H.P. , Meyer, M. , Mohr, P. , Puenterner, K. , Raab, S. , Ruf, A. , Schlatter, D. , Stihle, M.
Aleglitaar. a new. potent, and balanced dual ppara/g agonist for the treatment of type ii diabetes
Benz, J. , Bernardeau, A. , Binggeli, A. , Blum, D. , Boehringer, M. , Grether, U. , Gsell, B. , Hilpert, H. , Kuhn, B. , Maerki, H.P. , Meyer, M. , Mohr, P. , Puenterner, K. , Raab, S. , Ruf, A. , Schlatter, D. , Stihle, M.
Primary Citation of Related Structures: 3G9E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peroxisome proliferator-activated receptor gamma | A | 271 | Homo Sapiens , Synthetic Construct | ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY |
| Nuclear receptor coactivator 1 | B | 13 | Homo Sapiens , Synthetic Construct | QTSHKLVQLLTTT |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-02-13 Deposition Author(s): Benz, J. , Bernardeau, A. , Binggeli, A. , Blum, D. , Boehringer, M. , Grether, U. , Gsell, B. , Hilpert, H. , Kuhn, B. , Maerki, H.P. , Meyer, M. , Mohr, P. , Puenterner, K. , Raab, S. , Ruf, A. , Schlatter, D. , Stihle, M.