Crystal structure of the complex formed between a group ii phospholipase a2 and designed peptide inhibitor carbobenzoxy-dehydro-val-ala-arg-ser at 1.2 a resolution
PDB DOI: 10.2210/pdb3g8f/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Streptococcus Phage 73 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-02-12 Deposition Author(s): Betzel, C. , Dey, S. , Kaur, P. , Perbandt, M. , Prem Kumar, R. , Sharma, S. , Singh, N. , Singh, T.P. , Somvanshi, R.K.
Method: X-RAY DIFFRACTION Resolution: 1.25 Å
Crystal structure of the complex formed between a group ii phospholipase a2 and designed peptide inhibitor carbobenzoxy-dehydro-val-ala-arg-ser at 1.2 a resolution
Betzel, C. , Dey, S. , Kaur, P. , Perbandt, M. , Prem Kumar, R. , Sharma, S. , Singh, N. , Singh, T.P. , Somvanshi, R.K.
Primary Citation of Related Structures: 3G8F
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Phospholipase A2 VRV-PL-VIIIa | A | 121 | Streptococcus Phage 73 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC |
PHQ VAL ALA ARG SER peptide | B | 5 | Streptococcus Phage 73 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XVARS |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-02-12 Deposition Author(s): Betzel, C. , Dey, S. , Kaur, P. , Perbandt, M. , Prem Kumar, R. , Sharma, S. , Singh, N. , Singh, T.P. , Somvanshi, R.K.