Crystal structure of a redesigned tpr protein, t-mod(vmy), in complex with meevf peptide
PDB DOI: 10.2210/pdb3fwv/pdb
Classification: CHAPERONE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-01-19 Deposition Author(s): Jackrel, M.E. , Regan, L. , Valverde, R.
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Crystal structure of a redesigned tpr protein, t-mod(vmy), in complex with meevf peptide
Jackrel, M.E. , Regan, L. , Valverde, R.
Primary Citation of Related Structures: 3FWV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Hsc70/Hsp90-organizing protein | A | 128 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRMIAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ |
Hsc70/Hsp90-organizing protein | B | 128 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRMIAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ |
Heat shock protein HSP 90-beta | C | 6 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XMEEVF |
Heat shock protein HSP 90-beta | D | 6 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XMEEVF |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-01-19 Deposition Author(s): Jackrel, M.E. , Regan, L. , Valverde, R.