Crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution
PDB DOI: 10.2210/pdb3fsd/pdb
Classification: structural genomics, unknown function Organism(s): Rhodospirillum Rubrum Atcc 11170
Deposited: 2009-01-09 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 3FSD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NTF2-like protein of unknown function in nutrient uptake | A | 134 | Rhodospirillum Rubrum Atcc 11170 | GMSNALATLASPADDIAFYEERLRAAMLTGDLKGLETLLADDLAFVDHTGCVKTKQTHLEPYRAGLLKLSRLDLSDAVVRAAGEDGRVVVVRAVTAGVYDGEAFTETLRFTRIWRRTQGPAGWKLVAGHCSVIL |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-01-09 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)