3FMY
Structure of the c-terminal domain of the e. coli protein mqsa (ygit/b3021)
PDB DOI: 10.2210/pdb3fmy/pdb
Classification: DNA BINDING PROTEIN Organism(s): Sphingobium Sp. (Strain Nbrc 103272 / Syk-6)
Deposited: 2008-12-22 Deposition Author(s): Arruda, J.M. , Brown, B.L. , Page, R. , Peti, W.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Structure of the c-terminal domain of the e. coli protein mqsa (ygit/b3021)
Arruda, J.M. , Brown, B.L. , Page, R. , Peti, W.
Primary Citation of Related Structures: 3FMY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTH-type transcriptional regulator MQSA (ygiT/b3021) | A | 73 | Sphingobium Sp. (Strain Nbrc 103272 / Syk-6) | GHMASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2008-12-22 Deposition Author(s): Arruda, J.M. , Brown, B.L. , Page, R. , Peti, W.