Crystal structure of dsba-like thioredoxin domain vf_a0457 from vibrio fischeri
PDB DOI: 10.2210/pdb3feu/pdb
Classification: OXIDOREDUCTASE Organism(s): Vibrio Fischeri
Deposited: 2008-12-01 Deposition Author(s): Joachimiak, A. , Kim, Y. , Midwest Center For Structural Genomics (Mcsg) , Sather, A. , Shackelford, G.
Crystal structure of dsba-like thioredoxin domain vf_a0457 from vibrio fischeri
Joachimiak, A. , Kim, Y. , Midwest Center For Structural Genomics (Mcsg) , Sather, A. , Shackelford, G.
Primary Citation of Related Structures: 3FEU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| putative Lipoprotein | A | 185 | Vibrio Fischeri | SNADPKEGVQYEVLSTSLENDGMAPVTEVFALSCGHCRNMENFLPVISQEAGTDIGKMHITFNQSAHIASMFYYAAEMQVDGAPDHAFMEDLFAATQMGEGTTLTEQQEAYSKAFTSRGLVSPYDFNEEQRDTLIKKVDNAKMLSEKSGISSVPTFVVNGKYNVLIGGHDDPKQIADTIRYLLEK |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-12-01 Deposition Author(s): Joachimiak, A. , Kim, Y. , Midwest Center For Structural Genomics (Mcsg) , Sather, A. , Shackelford, G.