3F5H
Crystal structure of fused docking domains from pikaiii and pikaiv of the pikromycin polyketide synthase
PDB DOI: 10.2210/pdb3f5h/pdb
Classification: PROTEIN BINDING Organism(s): Streptomyces Venezuelae
Deposited: 2008-11-03 Deposition Author(s): Bartley, F.E. , Buchholz, T.J. , Geders, T.W. , Reynolds, K.A. , Sherman, D.H. , Smith, J.L.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.75 Å
Crystal structure of fused docking domains from pikaiii and pikaiv of the pikromycin polyketide synthase
Bartley, F.E. , Buchholz, T.J. , Geders, T.W. , Reynolds, K.A. , Sherman, D.H. , Smith, J.L.
Primary Citation of Related Structures: 3F5H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Type I polyketide synthase PikAIII, Type I polyketide synthase PikAIV fusion protein | A | 68 | Streptomyces Venezuelae | SNADPGAEPEASIDDLDAEALIRMALGPRNTMTSSNEQLVDALRASLKENEELRKESRRRADRRQEPM |
| Type I polyketide synthase PikAIII, Type I polyketide synthase PikAIV fusion protein | B | 68 | Streptomyces Venezuelae | SNADPGAEPEASIDDLDAEALIRMALGPRNTMTSSNEQLVDALRASLKENEELRKESRRRADRRQEPM |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2008-11-03 Deposition Author(s): Bartley, F.E. , Buchholz, T.J. , Geders, T.W. , Reynolds, K.A. , Sherman, D.H. , Smith, J.L.