Crystal structure of the n114q mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
PDB DOI: 10.2210/pdb3eg1/pdb
Classification: Transferase/Signaling protein Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2008-09-10 Deposition Author(s): Camara-Artigas, A.
Crystal structure of the n114q mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Primary Citation of Related Structures: 3EG1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase ABL1 | A | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS |
| Proto-oncogene tyrosine-protein kinase ABL1 | B | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS |
| p41 peptide | C | 11 | Homo Sapiens , Synthetic Construct | XAPSYSPPPPP |
| p41 peptide | D | 11 | Homo Sapiens , Synthetic Construct | XAPSYSPPPPP |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-09-10 Deposition Author(s): Camara-Artigas, A.