Crystal structure of the plasmodium falciparum ubiquitin conjugating enzyme complex, pfubc13-pfuev1a
PDB DOI: 10.2210/pdb3e95/pdb
Classification: LIGASE Organism(s): Plasmodium Falciparum 3D7
Deposited: 2008-08-21 Deposition Author(s): Ali, A. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Brand, V.B. , Brokx, S. , Edwards, A.M. , Hui, R. , Kozieradzki, I. , Lam, A. , Lew, J. , Lin, Y.H. , Qiu, W. , Ravichandran, M. , Schapira, M. , Structural Genomics Consortium (Sgc) , Vedadi, M. , Wasney, G. , Wernimont, A.K. , Wilkstrom, M. , Zhao, Y.
Crystal structure of the plasmodium falciparum ubiquitin conjugating enzyme complex, pfubc13-pfuev1a
Ali, A. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Brand, V.B. , Brokx, S. , Edwards, A.M. , Hui, R. , Kozieradzki, I. , Lam, A. , Lew, J. , Lin, Y.H. , Qiu, W. , Ravichandran, M. , Schapira, M. , Structural Genomics Consortium (Sgc) , Vedadi, M. , Wasney, G. , Wernimont, A.K. , Wilkstrom, M. , Zhao, Y.
Primary Citation of Related Structures: 3E95
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin carrier protein | A | 151 | Plasmodium Falciparum 3D7 | GIPRRITKETQNLANEPPPGIMAVPVPENYRHFNILINGPDGTPYEGGTYKLELFLPEQYPMEPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSSPEPDDPLDSKVAEHFKQDKNDAEHVARQWNKIYANNNVL |
| Ubiquitin carrier protein | B | 151 | Plasmodium Falciparum 3D7 | GIPRRITKETQNLANEPPPGIMAVPVPENYRHFNILINGPDGTPYEGGTYKLELFLPEQYPMEPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSSPEPDDPLDSKVAEHFKQDKNDAEHVARQWNKIYANNNVL |
| Ubiquitin-conjugating enzyme E2 | C | 158 | Plasmodium Falciparum 3D7 | MHHHHHHSSGRENLYFQGMSEVIVPRSFRLLDELERGQKGNVSEGVSFGLESADDITLSNWSCTIFGQPGTVFENRIYSLTIFCDDNYPDSPPTVKFDTKIEMSCVDNCGRVIKNNLHILKNWNRNYTIETILISLRQEMLSSANKRLPQPNEGEVYS |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-08-21 Deposition Author(s): Ali, A. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Brand, V.B. , Brokx, S. , Edwards, A.M. , Hui, R. , Kozieradzki, I. , Lam, A. , Lew, J. , Lin, Y.H. , Qiu, W. , Ravichandran, M. , Schapira, M. , Structural Genomics Consortium (Sgc) , Vedadi, M. , Wasney, G. , Wernimont, A.K. , Wilkstrom, M. , Zhao, Y.