Crystal structure of recx from lactobacillus salivarius
PDB DOI: 10.2210/pdb3e3v/pdb
Classification: RECOMBINATION Organism(s): Lactobacillus Salivarius
Deposited: 2008-08-08 Deposition Author(s): Agarwal, R. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.
Crystal structure of recx from lactobacillus salivarius
Agarwal, R. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.
Primary Citation of Related Structures: 3E3V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Regulatory protein recX | A | 177 | Lactobacillus Salivarius | MSLDENLIEEIKLADDISKGYNAALNYLSYQLRTRKEVEDKLRSLDIHEDYISEIINKLIDLDLINDKNYAESYVRTMMNTSDKGPKVIKLNLSKKGIDDNIAEDALILYTDKLQVEKGVTLAEKLANRYSHDSYRNKQNKIKQSLLTKGFSYDIIDTIIQELDLIFDDEGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-08-08 Deposition Author(s): Agarwal, R. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.