The structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide
PDB DOI: 10.2210/pdb3dnj/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Caulobacter Vibrioides , Synthetic Construct
Deposited: 2008-07-02 Deposition Author(s): Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T. , Wang, K.
The structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide
Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T. , Wang, K.
Primary Citation of Related Structures: 3DNJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATP-dependent Clp protease adapter protein clpS | A | 85 | Caulobacter Vibrioides , Synthetic Construct | TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD |
| ATP-dependent Clp protease adapter protein clpS | B | 85 | Caulobacter Vibrioides , Synthetic Construct | TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD |
| synthetic N-end rule peptide | C | 10 | Caulobacter Vibrioides , Synthetic Construct | YLFVQRDSKE |
| synthetic N-end rule peptide | D | 10 | Caulobacter Vibrioides , Synthetic Construct | YLFVQRDSKE |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-07-02 Deposition Author(s): Baker, T.A. , Grant, R.A. , Roman-Hernandez, G. , Sauer, R.T. , Wang, K.