Crystal structure of the complex of human chromobox homolog 3 (cbx3) with peptide
PDB DOI: 10.2210/pdb3dm1/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2008-06-30 Deposition Author(s): Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.
Crystal structure of the complex of human chromobox homolog 3 (cbx3) with peptide
Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.
Primary Citation of Related Structures: 3DM1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 3 | A | 58 | Homo Sapiens , Synthetic Construct | EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEK |
| Chromobox protein homolog 3 | C | 58 | Homo Sapiens , Synthetic Construct | EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEK |
| Chromobox protein homolog 3 | E | 58 | Homo Sapiens , Synthetic Construct | EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEK |
| Chromobox protein homolog 3 | G | 58 | Homo Sapiens , Synthetic Construct | EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEK |
| Histone-lysine N-methyltransferase, H3 lysine-9 specific 3 | B | 12 | Homo Sapiens , Synthetic Construct | KVHRARKTMSKP |
| Histone-lysine N-methyltransferase, H3 lysine-9 specific 3 | D | 12 | Homo Sapiens , Synthetic Construct | KVHRARKTMSKP |
| Histone-lysine N-methyltransferase, H3 lysine-9 specific 3 | F | 12 | Homo Sapiens , Synthetic Construct | KVHRARKTMSKP |
| Histone-lysine N-methyltransferase, H3 lysine-9 specific 3 | H | 12 | Homo Sapiens , Synthetic Construct | KVHRARKTMSKP |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-06-30 Deposition Author(s): Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.