Wild type hiv-1 protease with potent antiviral inhibitor grl-0255a
PDB DOI: 10.2210/pdb3djk/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus Type 1
Deposited: 2008-06-23 Deposition Author(s): Wang, Y.F. , Weber, I.T.
Wild type hiv-1 protease with potent antiviral inhibitor grl-0255a
Primary Citation of Related Structures: 3DJK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus Type 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| Protease | B | 99 | Human Immunodeficiency Virus Type 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-06-23 Deposition Author(s): Wang, Y.F. , Weber, I.T.