Crystal structure of a sam dependent methyltransferase from aquifex aeolicus
PDB DOI: 10.2210/pdb3dh0/pdb
Classification: TRANSFERASE Organism(s): Aquifex Aeolicus
Deposited: 2008-06-16 Deposition Author(s): Agarwal, R. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.
Crystal structure of a sam dependent methyltransferase from aquifex aeolicus
Agarwal, R. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.
Primary Citation of Related Structures: 3DH0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SAM dependent methyltransferase | A | 219 | Aquifex Aeolicus | MSLAHKFDPSKIKKLDDPSRLELFDPEKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVGEKGKVYAIDVQEEMVNYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELKRVAKPFAYLAIIDWKKEERDKGPPPEEVYSEWEVGLILEDAGIRVGRVVEVGKYCFGVYAMIVKQEEENPLMNVPFKIPPGEGHHHHHH |
| SAM dependent methyltransferase | B | 219 | Aquifex Aeolicus | MSLAHKFDPSKIKKLDDPSRLELFDPEKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVGEKGKVYAIDVQEEMVNYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELKRVAKPFAYLAIIDWKKEERDKGPPPEEVYSEWEVGLILEDAGIRVGRVVEVGKYCFGVYAMIVKQEEENPLMNVPFKIPPGEGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-06-16 Deposition Author(s): Agarwal, R. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.