A non-biological atp binding protein crystallized in the presence of 100 mm adp
PDB DOI: 10.2210/pdb3dgn/pdb
Classification: DE NOVO PROTEIN Organism(s): Unidentified
Deposited: 2008-06-13 Deposition Author(s): Allen, J.P. , Chaput, J.C. , Simmons, C.R.
A non-biological atp binding protein crystallized in the presence of 100 mm adp
Allen, J.P. , Chaput, J.C. , Simmons, C.R.
Primary Citation of Related Structures: 3DGN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATP Binding Protein-DX | A | 81 | Unidentified | GSMDYKDDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADSKEISNT |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-06-13 Deposition Author(s): Allen, J.P. , Chaput, J.C. , Simmons, C.R.