Crystal structure analysis of 1,5-alpha-arabinanase catalytic mutant (abnbe201a) complexed to arabinotriose
PDB DOI: 10.2210/pdb3d5z/pdb
Classification: HYDROLASE Organism(s): Geobacillus Stearothermophilus
Deposited: 2008-05-18 Deposition Author(s): Alhassid, A. , Ben David, A. , Shoham, G. , Shoham, Y.
Crystal structure analysis of 1,5-alpha-arabinanase catalytic mutant (abnbe201a) complexed to arabinotriose
Alhassid, A. , Ben David, A. , Shoham, G. , Shoham, Y.
Primary Citation of Related Structures: 3D5Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Intracellular arabinanase | A | 314 | Geobacillus Stearothermophilus | VHFHPFGGVNFYEMDWSLKGDLWAHDPVIAKEGSRWYVFHTGSGIQIKTSEDGVHWENMGWVFPSLPDWYKQYVPEKDEDHLWAPDICFYNGIYYLYYSVSTFGKNTSVIGLATNQTLDPRDPDYEWKDMGPVIHSTASDNYNAIDPNVVFDQEGQPWLSFGSFWSGIQLIQLDTETMKPAAQAELLTIASRGEEPNAIAAPFIVCRNGYYYLFVSFDFCCRGIESTYKIAVGRSKDITGPYVDKNGVSMMQGGGTILDEGNDRWIGPGHCAVYFSGVSAILVNHAYDALKNGEPTLQIRPLYWDDEGWPYLSV |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-05-18 Deposition Author(s): Alhassid, A. , Ben David, A. , Shoham, G. , Shoham, Y.