Crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum
PDB DOI: 10.2210/pdb3cp0/pdb
Classification: MEMBRANE PROTEIN Organism(s): Corynebacterium Glutamicum Atcc 13032
Deposited: 2008-03-30 Deposition Author(s): Abdullah, J. , Joachimiak, A. , Kim, Y. , Midwest Center For Structural Genomics (Mcsg) , Tesar, C.
Method: X-RAY DIFFRACTION Resolution: 1.65 Å
Crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum
Abdullah, J. , Joachimiak, A. , Kim, Y. , Midwest Center For Structural Genomics (Mcsg) , Tesar, C.
Primary Citation of Related Structures: 3CP0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Membrane protein implicated in regulation of membrane protease activity | A | 82 | Corynebacterium Glutamicum Atcc 13032 | SNARPAIRKRLLKPKVLDSSPRALVGHRAEVLEDVGATSGQVRLDGSIWSARSMDPTHTFAEGEIVSVIDIQGTTAIVWKEA |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-03-30 Deposition Author(s): Abdullah, J. , Joachimiak, A. , Kim, Y. , Midwest Center For Structural Genomics (Mcsg) , Tesar, C.