Structure of a homeodomain in complex with dna
PDB DOI: 10.2210/pdb3cmy/pdb
Classification: TRANSCRIPTION REGULATOR/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2008-03-24 Deposition Author(s): Birrane, G. , Ladias, J.A.A. , Soni, A.
Structure of a homeodomain in complex with dna
Birrane, G. , Ladias, J.A.A. , Soni, A.
Primary Citation of Related Structures: 3CMY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Paired box protein Pax-3 | A | 61 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQA |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-03-24 Deposition Author(s): Birrane, G. , Ladias, J.A.A. , Soni, A.