Structure of a homeodomain in complex with dna
PDB DOI: 10.2210/pdb3cmy/pdb
Classification: TRANSCRIPTION REGULATOR/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2008-03-24 Deposition Author(s): Birrane, G. , Ladias, J.A.A. , Soni, A.
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Structure of a homeodomain in complex with dna
Birrane, G. , Ladias, J.A.A. , Soni, A.
Primary Citation of Related Structures: 3CMY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Paired box protein Pax-3 | A | 61 | Homo Sapiens , Synthetic Construct | GQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQA |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-03-24 Deposition Author(s): Birrane, G. , Ladias, J.A.A. , Soni, A.