Crystal structure of sterol carrier protein-2 like-3 (scp2-l3) from aedes aegypti
PDB DOI: 10.2210/pdb3bks/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Aedes Aegypti
Deposited: 2007-12-07 Deposition Author(s): Dyer, D.H. , Forest, K.T. , Lan, Q.
Crystal structure of sterol carrier protein-2 like-3 (scp2-l3) from aedes aegypti
Dyer, D.H. , Forest, K.T. , Lan, Q.
Primary Citation of Related Structures: 3BKS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sterol Carrier Protein-2 like-3 | A | 126 | Aedes Aegypti | GSPGIRMALKTDQILDKLNEKLAQVDRSKRSFTVILFVHLRQEGKVVRSVVLDFNDLKISEIELAVTSTADYPAERIDASITIDDNDFYLVATKETSFAALIEQGKVDITGNKQAFLTLDEKFRNK |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-12-07 Deposition Author(s): Dyer, D.H. , Forest, K.T. , Lan, Q.