Crystal structure of rat tom20-aldh presequence complex: a complex (form1) between tom20 and a disulfide-bridged presequence peptide containing d-cys and l-cys at the i and i+3 positions.
PDB DOI: 10.2210/pdb3ax5/pdb
Classification: MEMBRANE PROTEIN/TRANSPORT PROTEIN Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2011-03-29 Deposition Author(s): Kohda, D. , Maita, Y. , Saitoh, T.
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Crystal structure of rat tom20-aldh presequence complex: a complex (form1) between tom20 and a disulfide-bridged presequence peptide containing d-cys and l-cys at the i and i+3 positions.
Kohda, D. , Maita, Y. , Saitoh, T.
Primary Citation of Related Structures: 3AX5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitochondrial import receptor subunit TOM20 homolog | A | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL |
| Mitochondrial import receptor subunit TOM20 homolog | C | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL |
| Aldehyde dehydrogenase, mitochondrial | B | 11 | Rattus Norvegicus , Synthetic Construct | GCRLCRLLSYA |
| Aldehyde dehydrogenase, mitochondrial | D | 11 | Rattus Norvegicus , Synthetic Construct | GCRLCRLLSYA |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-29 Deposition Author(s): Kohda, D. , Maita, Y. , Saitoh, T.