Crystal structure of rat tom20-aldh presequence complex: a disulfide-tethered complex with a non-optimized, long linker
PDB DOI: 10.2210/pdb3ax2/pdb
Classification: MEMBRANE PROTEIN/TRANSPORT PROTEIN Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2011-03-28 Deposition Author(s): Kohda, D. , Maita, Y. , Saitoh, T.
Crystal structure of rat tom20-aldh presequence complex: a disulfide-tethered complex with a non-optimized, long linker
Kohda, D. , Maita, Y. , Saitoh, T.
Primary Citation of Related Structures: 3AX2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Mitochondrial import receptor subunit TOM20 homolog | A | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL |
Mitochondrial import receptor subunit TOM20 homolog | C | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL |
Mitochondrial import receptor subunit TOM20 homolog | E | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL |
Mitochondrial import receptor subunit TOM20 homolog | G | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL |
Aldehyde dehydrogenase, mitochondrial | B | 16 | Rattus Norvegicus , Synthetic Construct | GPRLSRLLSYAGSGCX |
Aldehyde dehydrogenase, mitochondrial | D | 16 | Rattus Norvegicus , Synthetic Construct | GPRLSRLLSYAGSGCX |
Aldehyde dehydrogenase, mitochondrial | F | 16 | Rattus Norvegicus , Synthetic Construct | GPRLSRLLSYAGSGCX |
Aldehyde dehydrogenase, mitochondrial | H | 16 | Rattus Norvegicus , Synthetic Construct | GPRLSRLLSYAGSGCX |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-28 Deposition Author(s): Kohda, D. , Maita, Y. , Saitoh, T.