Crystal structure of rat tom20-aldh presequence complex: the intermolecular disulfide bond was cleaved in the crystal of a disulfide-tethered complex.
PDB DOI: 10.2210/pdb3awr/pdb
Classification: MEMBRANE PROTEIN/TRANSPORT PROTEIN Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2011-03-26 Deposition Author(s): Igura, M. , Kohda, D. , Ose, T.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitochondrial import receptor subunit TOM20 homolog | A | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL |
| Mitochondrial import receptor subunit TOM20 homolog | B | 73 | Rattus Norvegicus , Synthetic Construct | GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL |
| Aldehyde dehydrogenase, mitochondrial | C | 13 | Rattus Norvegicus , Synthetic Construct | GPRLSRLLSSAGC |
| Aldehyde dehydrogenase, mitochondrial | D | 13 | Rattus Norvegicus , Synthetic Construct | GPRLSRLLSSAGC |
Method: X-RAY DIFFRACTION