A simplified bpti variant stabilized by the a14g and a38v substitutions
PDB DOI: 10.2210/pdb3aub/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Parengyodontium Album
Deposited: 2011-02-03 Deposition Author(s): Islam, M.M. , Kato, A. , Khan, M.M.A. , Kidokoro, S.I. , Kuroda, Y. , Noguchi, K. , Yohda, M.
A simplified bpti variant stabilized by the a14g and a38v substitutions
Islam, M.M. , Kato, A. , Khan, M.M.A. , Kidokoro, S.I. , Kuroda, Y. , Noguchi, K. , Yohda, M.
Primary Citation of Related Structures: 3AUB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bovine Pancreatic trypsin inhibitor | A | 58 | Parengyodontium Album | RPAFCLEPPYAGPGKARIIRYFYNAAAGAAQAFVYGGVRAKRNNFASAADALAACAAA |
Bovine Pancreatic trypsin inhibitor | B | 58 | Parengyodontium Album | RPAFCLEPPYAGPGKARIIRYFYNAAAGAAQAFVYGGVRAKRNNFASAADALAACAAA |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-02-03 Deposition Author(s): Islam, M.M. , Kato, A. , Khan, M.M.A. , Kidokoro, S.I. , Kuroda, Y. , Noguchi, K. , Yohda, M.