Structure of uhrf1 in complex with histone tail
PDB DOI: 10.2210/pdb3asl/pdb
Classification: LIGASE/DNA BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-12-16 Deposition Author(s): Arita, K. , Ariyoshi, M. , Hamamoto, R. , Sekiyama, N. , Shirakawa, M. , Sugita, K. , Tochio, H. , Unoki, M.
Structure of uhrf1 in complex with histone tail
Arita, K. , Ariyoshi, M. , Hamamoto, R. , Sekiyama, N. , Shirakawa, M. , Sugita, K. , Tochio, H. , Unoki, M.
Primary Citation of Related Structures: 3ASL
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase UHRF1 | A | 70 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDA |
Histone H3.3 | B | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKST |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-12-16 Deposition Author(s): Arita, K. , Ariyoshi, M. , Hamamoto, R. , Sekiyama, N. , Shirakawa, M. , Sugita, K. , Tochio, H. , Unoki, M.