Crystal structure of the rat vitamin d receptor ligand binding domain complexed with tei-9647 and a synthetic peptide containing the nr2 box of drip 205
PDB DOI: 10.2210/pdb3a2h/pdb
Classification: HORMONE RECEPTOR, TRANSCRIPTION Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2009-05-20 Deposition Author(s): Kakuda, S. , Takimoto-Kamimura, M.
Method: X-RAY DIFFRACTION Resolution: 2.5 Å
Crystal structure of the rat vitamin d receptor ligand binding domain complexed with tei-9647 and a synthetic peptide containing the nr2 box of drip 205
Kakuda, S. , Takimoto-Kamimura, M.
Primary Citation of Related Structures: 3A2H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Vitamin D3 receptor | A | 265 | Rattus Norvegicus , Synthetic Construct | GSHMLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSVTLDLSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNEIS |
| Mediator of RNA polymerase II transcription subunit 1 peptide | B | 13 | Rattus Norvegicus , Synthetic Construct | KNHPMLMNLLKDN |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-05-20 Deposition Author(s): Kakuda, S. , Takimoto-Kamimura, M.