Crystal structure of aristaless homeodomain
PDB DOI: 10.2210/pdb3a02/pdb
Classification: GENE REGULATION Organism(s): Drosophila Melanogaster
Deposited: 2009-02-28 Deposition Author(s): Kojima, T. , Miyazono, K. , Nagata, K. , Saigo, K. , Tanokura, M.
Crystal structure of aristaless homeodomain
Kojima, T. , Miyazono, K. , Nagata, K. , Saigo, K. , Tanokura, M.
Primary Citation of Related Structures: 3A02
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Homeobox protein aristaless | A | 60 | Drosophila Melanogaster | GSHMTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKV |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-02-28 Deposition Author(s): Kojima, T. , Miyazono, K. , Nagata, K. , Saigo, K. , Tanokura, M.