Crystal structure of the transcriptional repressor pagr of bacillus anthracis
PDB DOI: 10.2210/pdb2zkz/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Anthracis
Deposited: 2008-04-01 Deposition Author(s): Varughese, K.I. , Veldore, V.H. , Volkov, A. , Zhao, H.
Crystal structure of the transcriptional repressor pagr of bacillus anthracis
Varughese, K.I. , Veldore, V.H. , Volkov, A. , Zhao, H.
Primary Citation of Related Structures: 2ZKZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional repressor pagR | A | 99 | Bacillus Anthracis | MTVFVDHKIEYMSLEDDAELLKTMAHPMRLKIVNELYKHKALNVTQIIQILKLPQSTVSQHLCKMRGKVLKRNRQGLEIYYSINNPKVEGIIKLLNPIQ |
| Transcriptional repressor pagR | B | 99 | Bacillus Anthracis | MTVFVDHKIEYMSLEDDAELLKTMAHPMRLKIVNELYKHKALNVTQIIQILKLPQSTVSQHLCKMRGKVLKRNRQGLEIYYSINNPKVEGIIKLLNPIQ |
| Transcriptional repressor pagR | C | 99 | Bacillus Anthracis | MTVFVDHKIEYMSLEDDAELLKTMAHPMRLKIVNELYKHKALNVTQIIQILKLPQSTVSQHLCKMRGKVLKRNRQGLEIYYSINNPKVEGIIKLLNPIQ |
| Transcriptional repressor pagR | D | 99 | Bacillus Anthracis | MTVFVDHKIEYMSLEDDAELLKTMAHPMRLKIVNELYKHKALNVTQIIQILKLPQSTVSQHLCKMRGKVLKRNRQGLEIYYSINNPKVEGIIKLLNPIQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-04-01 Deposition Author(s): Varughese, K.I. , Veldore, V.H. , Volkov, A. , Zhao, H.