Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with adenosine and biotin, mutations r48a and k111a
PDB DOI: 10.2210/pdb2zgw/pdb
Classification: LIGASE Organism(s): Pyrococcus Horikoshii
Deposited: 2008-01-28 Deposition Author(s): Bagautdinov, B. , Bagautdinova, S. , Kunishima, N. , Matsuura, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with adenosine and biotin, mutations r48a and k111a
Bagautdinov, B. , Bagautdinova, S. , Kunishima, N. , Matsuura, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Primary Citation of Related Structures: 2ZGW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| biotin--[acetyl-CoA-carboxylase] ligase | A | 235 | Pyrococcus Horikoshii | MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL |
| biotin--[acetyl-CoA-carboxylase] ligase | B | 235 | Pyrococcus Horikoshii | MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-01-28 Deposition Author(s): Bagautdinov, B. , Bagautdinova, S. , Kunishima, N. , Matsuura, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi)