Solution structure of the short-isoform of the second ww domain from the human membrane-associated guanylate kinase, ww and pdz domain-containing protein 1 (magi-1)
PDB DOI: 10.2210/pdb2zaj/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2007-10-05 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Watanabe, S. , Yokoyama, S.
Solution structure of the short-isoform of the second ww domain from the human membrane-associated guanylate kinase, ww and pdz domain-containing protein 1 (magi-1)
Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2ZAJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | A | 49 | Homo Sapiens | GSSGSSGLDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-10-05 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Watanabe, S. , Yokoyama, S.