Crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x
PDB DOI: 10.2210/pdb2z8l/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Staphylococcus Aureus
Deposited: 2007-09-06 Deposition Author(s): Baker, E.N. , Baker, H.M. , Basu, I. , Caradoc Davies, T. , Chung, M.C. , Fraser, J.D.
Crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x
Baker, E.N. , Baker, H.M. , Basu, I. , Caradoc Davies, T. , Chung, M.C. , Fraser, J.D.
Primary Citation of Related Structures: 2Z8L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Exotoxin 3 | A | 208 | Staphylococcus Aureus | GPGSSEHKAKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-09-06 Deposition Author(s): Baker, E.N. , Baker, H.M. , Basu, I. , Caradoc Davies, T. , Chung, M.C. , Fraser, J.D.