Crystal structure of the n-terminal duf1126 in human ef-hand domain
PDB DOI: 10.2210/pdb2z13/pdb
Classification: Structural genomics, unknown function Organism(s): Homo Sapiens
Deposited: 2007-05-07 Deposition Author(s): Kigawa, T. , Kishishita, S. , Murayama, K. , Nishino, A. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Shirouzu, M. , Terada, T. , Yokoyama, S.
Crystal structure of the n-terminal duf1126 in human ef-hand domain
Kigawa, T. , Kishishita, S. , Murayama, K. , Nishino, A. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2Z13
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| EF-hand domain-containing family member C2 | A | 133 | Homo Sapiens | GSSGSSGWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPEVKNSGLLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKMGVKVNPPVQSGPSSG |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-05-07 Deposition Author(s): Kigawa, T. , Kishishita, S. , Murayama, K. , Nishino, A. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Shirouzu, M. , Terada, T. , Yokoyama, S.