Crystal structure of putative acetyltransferase
PDB DOI: 10.2210/pdb2z0z/pdb
Classification: TRANSFERASE Organism(s): Thermus Thermophilus
Deposited: 2007-05-07 Deposition Author(s): Kato-Murayama, M. , Kuramitsu, S. , Murayama, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Crystal structure of putative acetyltransferase
Kato-Murayama, M. , Kuramitsu, S. , Murayama, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2Z0Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative uncharacterized protein TTHA1799 | A | 194 | Thermus Thermophilus | MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVYRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKYLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLYGASGNP |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-05-07 Deposition Author(s): Kato-Murayama, M. , Kuramitsu, S. , Murayama, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.