Solution structure of the ww domain from the human syntaxin-binding protein 4
PDB DOI: 10.2210/pdb2ysg/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.
Solution structure of the ww domain from the human syntaxin-binding protein 4
Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2YSG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Syntaxin-binding protein 4 | A | 40 | Homo Sapiens | GSSGSSGLPYGWEEAYTADGIKYFINHVTQTTSWIHPVMS |
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.