Solution structure of the second ww domain from the human membrane-associated guanylate kinase, ww and pdz domain-containing protein 1. magi-1
PDB DOI: 10.2210/pdb2yse/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Watanabe, S. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the second ww domain from the human membrane-associated guanylate kinase, ww and pdz domain-containing protein 1. magi-1
Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2YSE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | A | 60 | Homo Sapiens | GSSGSSGLDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLESGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Watanabe, S. , Yokoyama, S.