Solution structure of the ww domain from the human amyloid beta a4 precursor protein-binding family b member 3, apbb3
PDB DOI: 10.2210/pdb2ysc/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S. , Yoneyama, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the ww domain from the human amyloid beta a4 precursor protein-binding family b member 3, apbb3
Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 2YSC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Amyloid beta A4 precursor protein-binding family B member 3 | A | 39 | Homo Sapiens | GSSGSSGGLPPGWRKIHDAAGTYYWHVPSGSTQWQRPTW |
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S. , Yoneyama, M.