Structure of the third homeodomain from the human homeobox and leucine zipper protein, homez
PDB DOI: 10.2210/pdb2ys9/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Watanabe, S. , Yokoyama, S.
Structure of the third homeodomain from the human homeobox and leucine zipper protein, homez
Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2YS9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Homeobox and leucine zipper protein Homez | A | 70 | Homo Sapiens | GSSGSSGPLPIPPPPPDIQPLERYWAAHQQLRETDIPQLSQASRLSTQQVLDWFDSRLPQPAEVSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-04-03 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Watanabe, S. , Yokoyama, S.