2YQK
Solution structure of the sant domain in arginine-glutamic acid dipeptide (re) repeats
PDB DOI: 10.2210/pdb2yqk/pdb
Classification: TRANSCRIPTION/APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2007-03-30 Deposition Author(s): He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the sant domain in arginine-glutamic acid dipeptide (re) repeats
He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2YQK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Arginine-glutamic acid dipeptide repeats protein | A | 63 | Homo Sapiens | GSSGSSGIEKCWTEDEVKRFVKGLRQYGKNFFRIRKELLPNKETGELITFYYYWKKTSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-03-30 Deposition Author(s): He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.