Crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period
PDB DOI: 10.2210/pdb2yn1/pdb
Classification: OXIDOREDUCTASE Organism(s): Synthetic Construct
Deposited: 2012-10-11 Deposition Author(s): Gavira, J.A. , Ibarra-Molero, B. , Ingles-Prieto, A. , Sanchez-Ruiz, J.M.
Crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period
Gavira, J.A. , Ibarra-Molero, B. , Ingles-Prieto, A. , Sanchez-Ruiz, J.M.
Primary Citation of Related Structures: 2YN1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| LGPCA THIOREDOXIN | A | 106 | Synthetic Construct | MSIIHVTDDSFDQDVLKADKPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLKVAKVNIDENPETAAKYGIRGIPTLMLFKNGEVAATKVGALSKSQLKEFLDANL |
| LGPCA THIOREDOXIN | B | 106 | Synthetic Construct | MSIIHVTDDSFDQDVLKADKPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLKVAKVNIDENPETAAKYGIRGIPTLMLFKNGEVAATKVGALSKSQLKEFLDANL |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-11 Deposition Author(s): Gavira, J.A. , Ibarra-Molero, B. , Ingles-Prieto, A. , Sanchez-Ruiz, J.M.