The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291v mutant
PDB DOI: 10.2210/pdb2y21/pdb
Classification: MEMBRANE PROTEIN Organism(s): Archaeoglobus Fulgidus
Deposited: 2010-12-12 Deposition Author(s): Ferris, H.U. , Hulko, M. , Lupas, A.N. , Zeth, K.
The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291v mutant
Ferris, H.U. , Hulko, M. , Lupas, A.N. , Zeth, K.
Primary Citation of Related Structures: 2Y21
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HAMP | A | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | B | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | C | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | D | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | E | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | F | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | G | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | H | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | I | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | J | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | K | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
| HAMP | L | 56 | Archaeoglobus Fulgidus | HMSTITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-12-12 Deposition Author(s): Ferris, H.U. , Hulko, M. , Lupas, A.N. , Zeth, K.