High resolution structure of mtsl-tagged cylr2.
PDB DOI: 10.2210/pdb2xiu/pdb
Classification: DNA BINDING PROTEIN Organism(s): Enterococcus Faecalis
Deposited: 2010-07-01 Deposition Author(s): Becker, S. , Cho, M.-K. , Giller, K. , Grosse, C. , Gruene, T. , Karyagina, I. , Kim, H.-Y. , Zweckstetter, M.
High resolution structure of mtsl-tagged cylr2.
Becker, S. , Cho, M.-K. , Giller, K. , Grosse, C. , Gruene, T. , Karyagina, I. , Kim, H.-Y. , Zweckstetter, M.
Primary Citation of Related Structures: 2XIU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CYLR2 | A | 66 | Enterococcus Faecalis | MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNCPLEDIFQWQPE |
| CYLR2 | B | 66 | Enterococcus Faecalis | MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNCPLEDIFQWQPE |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-07-01 Deposition Author(s): Becker, S. , Cho, M.-K. , Giller, K. , Grosse, C. , Gruene, T. , Karyagina, I. , Kim, H.-Y. , Zweckstetter, M.